cpc.gov.aeScreenshot being generated…

cpc.gov.ae website report

Crown Prince Court

Cpc is ranked #2,524,585 worldwide (top 75%), has an estimated value of $470. It may earn around $71 per month from advertising.

Arabic

Visit website Update data Similar sites

Last updated 4 months ago

Estimated worth

$470

Automated valuation

Global rank

#2,524,585

Improving

Monthly visitors

739

37K page views

Domain age

—

Creation date unknown

Hosted in

United Arab Emirates

Abu Dhabi Systems and Information Center

Security headers

55/100

Response 0.69 s

Key facts about cpc.gov.ae

Domain: cpc.gov.ae
Website name: Crown Prince Court
Estimated worth: $470
Global rank: #2,524,585 (top 75% of 3.4M ranked sites)
Monthly visitors (est.): 739 · 37K page views
Server location: Abu Dhabi, United Arab Emirates
Network: Abu Dhabi Systems and Information Center AS201678
Language: Arabic
Data updated: July 13, 2026

Estimated traffic & revenue

	Page views	Visitors	Ad revenue
Daily	1,231	25	$2
Monthly	36,944	739	$71
Yearly	443,328	8,868	$852

Modelled from the global rank — not measured analytics. Use them to compare sites, not as exact figures.

Global rank history

Monthly values

Month	Global rank
2026-06	#37,921,260
2026-07	#2,524,585

Source: Rankeez (Tranco, Majestic, DomCop, Cisco Umbrella).

How we estimate cpc.gov.ae's value

$470

The estimate is the higher of two independent approaches, both computed automatically from public data.

Traffic value: $470Driven by the global rank #2,524,585 (≈37K page views / month) plus a capped age bonus.
Activity value: $415Domain age plus observable signs of an active, professionally run website.

Activity signals found

Domain age (unknown)	$100
Active website with metadata	+$150
Security headers (55/100)	+$165

Revenue, sales or private analytics are not public and are not included. This is not an appraisal or a sale price.

On-page SEO

Title	Crown Prince Court 18 chars
Meta description	Missing
Meta keywords	None
Language	Arabic
Response time	0.69 s Fast

Homepage structure

H1 headings0

H2 headings0

H3 headings0

H4 headings0

Paragraphs0

Links3

Images1

Bold text0

No H1 heading found in the server HTML.

Technology & infrastructure

CDN / proxy	None detected
Web server	Not disclosed
Platform / language	Not disclosed
DNS provider	Unknown
Email provider	No MX record
SPF record	Missing
IPv6 (AAAA)	No
CAA record	No

Services verified in DNS

No third-party verification records found.

Domain name

Extension	.ae — the country-code extension of United Arab Emirates
Name length	3 characters Short
Hyphens / digits	No hyphen · no digits

Security headers

4 passed · 3 to improve · 3 missing
Homepage answered HTTP 200 at https://cpc.gov.ae/ · checked Oct 22, 2026

HTTPSThe homepage is served over an encrypted HTTPS connection.
HTTP → HTTPS redirectVisitors typing http:// are redirected to the secure version.
Strict-Transport-Security (HSTS)Not set: browsers may still try plain HTTP first.
Content-Security-PolicyNot set: no restriction on which scripts may run.
Clickjacking protectionX-Frame-Options: Sameorigin prevents the site from being framed by others.
X-Content-Type-OptionsNot set to nosniff.
Referrer-PolicyNot set (browsers default to strict-origin-when-cross-origin).
Permissions-PolicyNot set: browser features are not explicitly restricted.
Cookie flags4 cookie(s) set; WWWCPC (no SameSite), TS01fe39b9 (no Secure/HttpOnly/SameSite), TSe8cdd6a6029 (no Secure/HttpOnly/SameSite).
Software version disclosureNo software version numbers disclosed in headers.

Raw HTTP response headers

HTTP/1.1 200 OK
Content-Type: text/html
Last-Modified: Thu, 04 Sep 2025 10:31:12 GMT
Accept-Ranges: bytes
ETag: "7d1b209871ddc1:0"
Date: Thu, 22 Oct 2026 16:53:18 GMT
Set-Cookie: WWWCPC=!UgMXtCUS/5cpYiFgVd6gVpbkAgQKp9dvatZFXOz1rfO1WnTeQF0ftbV4BJHWzt+XS4H8Q+2FWFrZApQ=; path=/; Httponly; Secure, TS01fe39b9=01806343da75800a22f6f11de2b78c1abcbb785d4407326949b7cb0398a2bb9fc5afa492bcd1584bc274a73ba8e2b4cd7bb59c636b1d89be2182e1a3af8add908b5bc04d7f; Path=/; Domain=.cpc.gov.ae, TSe8cdd6a6029=086da99dd7ab2800a11ae1e8a55dd3ce7ec056f393f71f4885c9c197668d98a38fd3c001fa6c2bf245537145214c36e1; Max-Age=30; Path=/, TS0f7f6be8027=086da99dd7ab20003b9c947298391e8c5fd114d7e8d31994b68420b40beecd858a8641e9bac4311c08966c991d1130005575746b6f5c3efef68941e7efdc8d7d6b2fb1a9401c85f0c9625e700ce6700dc4758e82b94a422945fb1c92eb41258c; Path=/
X-Frame-Options: Sameorigin
Transfer-Encoding: chunked

Hosting

IP address	`185.66.19.193`
Location	Abu Dhabi, United Arab Emirates
Network (ISP)	Abu Dhabi Systems and Information Center
Autonomous system	AS201678 Abu Dhabi Systems and Information Center

Nameservers

Host	IP	Country
ns1.aedns.ae	`79.98.120.73`	—
nsext-pch.aedns.ae	`199.4.137.1`	—
ns2.aedns.ae	`79.98.121.73`	—
ns4.apnic.net	`202.12.31.53`	—

Domain registration (WHOIS)

Registrar	Unknown

Websites similar to cpc.gov.ae

More alternatives on Similars.net →

crownprince.com Sustainable Canned Seafood, Recipes, Coupons | Crown Prince Inc. #13,316,987$456

princewilliamvirginiatrafficlawyer.com Prince William Traffic Court Tickets Lawyer VA Manassas – Call 888-437-7747 #27,818,221$318

princetennis.com Prince Tennis #987,102$1,682

portraitcameos.com Home #11,403,013$348

princesquash.com Prince Tennis #18,780,093$437

cpc.gov.ae compared with similar websites

Website	Global rank	Est. worth	Registered	Hosted in
cpc.gov.ae	#2,524,585	$470	—	United Arab Emirates
crownprince.com	#13,316,987	$456	1996	United States
princewilliamvirginiatrafficlawyer.com	#27,818,221	$318	2007	United States
princetennis.com	#987,102	$1,682	1996	United States
portraitcameos.com	#11,403,013	$348	2009	Canada
princesquash.com	#18,780,093	$437	1997	United States

Websites ranked near cpc.gov.ae

#2,524,580 ephratacloister.org $785
#2,524,580 ryxi.com $755
#2,524,583 ajaxy.org $665
#2,524,584 plainlanguage.com $815
#2,524,585 cpc.gov.ae $470
#2,524,588 enjoy-swimming.com $680
#2,524,590 angrymarks.com $755
#2,524,595 kelliward.com $755
#2,524,595 cvsdvt.org $590

Questions about cpc.gov.ae

Where is cpc.gov.ae hosted?

Cpc.gov.ae's server (IP 185.66.19.193) is located in Abu Dhabi, United Arab Emirates.

How much is cpc.gov.ae worth?

We estimate cpc.gov.ae is worth $470. This is an automated estimate based on the site's global traffic rank, domain age and observable activity signals (professional email, business services, security, CDN) — not a professional appraisal or a real sale price.

How much traffic does cpc.gov.ae get?

Based on its rank, cpc.gov.ae receives roughly 739 unique visitors and 37K page views per month. These figures are modelled from the rank, not measured.

What is cpc.gov.ae's global rank?

Cpc.gov.ae has an estimated global rank of 2,524,585, sourced from Rankeez.com, which aggregates the Tranco, Majestic, DomCop and Cisco Umbrella rankings. Its rank has improved over the tracked period. This is an independent estimate, not affiliated with Amazon Alexa, which discontinued its own ranking service in 2022.

Who hosts cpc.gov.ae?

Cpc.gov.ae resolves to 185.66.19.193, on the network of Abu Dhabi Systems and Information Center (AS201678).

What websites are similar to cpc.gov.ae?

Popular websites in the same category as cpc.gov.ae include crownprince.com, princewilliamvirginiatrafficlawyer.com, princetennis.com, portraitcameos.com, princesquash.com.

Own cpc.gov.ae? Add the badge

<a href="https://statmemory.com/cpc.gov.ae"><img src="https://statmemory.com/badge/cpc.gov.ae.svg" alt="cpc.gov.ae on StatMemory" height="20"></a>

Shows your live global rank. To cite this report: “StatMemory, cpc.gov.ae website report, https://statmemory.com/cpc.gov.ae”.

StatMemory is not affiliated with cpc.gov.ae. This report shows publicly available data (DNS, WHOIS, HTTP headers, public top-site lists) and automated estimates for information purposes.